HomeMy WebLinkAboutB15-0026_M4.0_1438367880.pdfMechanical Specifications
General
1. Immediately notify the Engineer of any discrepancies.
2. It shall be assumed that all subcontractors are experienced and thoroughly knowledgeable in their respective areas of the construction industry
and shall perform in a responsible manner in an appropriate construction sequence.
3. Do not scale drawings. Verify dimensions in field prior to commencement of work.
4. It is the intent of these drawings and specifications to establish a standard of quality. The Engineer reserves the right to take exceptions to
approve methods and materials not reflected herein.
5. Failure to order, or release order, for materials and/or equipment will not be accepted as a reason to substitute alternate materials, equipment,
or installation methods.
6. Work shall be performed in a workmanlike manner to the satisfaction of the Architect & the Engineer.
7. Labor, materials, and equipment shall conform to the latest applicable editions of local, State of Colorado, and National Codes and ordinances.
If conflict between those publications exists, the most stringent requirement shall apply.
8. Provide record drawings to architect. Drawings shall include all addendum items, change orders, alterations, re-routings, etc.
9. The drawings show the intent of the mechanical systems but do not show all details required. It is the responsibility of the Contractors to
install complete & operable systems, which conform to the manufacturers' installations instructions & industry standards.
10. Systems shall be tested for proper operation. If tests show work is defective, Contractor shall make corrections necessary at no cost to Owner.
11. It is the Contractors' and manufacturers' responsibility to assure themselves that the code authorities will approve any product to be installed
on the project.
12. Systems shall be professionally labeled. Piping shall be labeled with color coded commercial grade labels indicating piping service and flow
direction. Equipment, pumps and valves shall be labeled with engraved plastic or metal tags and an equipment/valve schedule shall be
provided and mounted on the mechanical room wall. Equipment labels shall follow the same nomenclature as the mechanical drawings.
13. 3URYLGH´KLJKOHYHOFRQFUHWHHTXLSPHQWSDGVEHQHDWKJDVILUHGIORRUPRXQWHGPHFKDQLFDOHTXLSPHQWLQPHFKDQLFDOURRP
14. See architectural reflected ceiling plan for all ceiling penetrations.
15. Coordinate architectural, structural, electrical, landscaping, fire protection, and interior design drawings with mechanical drawings prior to
installation.
16. Offset piping, ductwork, etc. as necessary to accommodate structure, beams, columns, and existing equipment.
Shop Drawings
17. Submit entire HVAC shop drawing submittal data at one time. Submittal to be bound in three-ring binders, indexed in a neat and orderly
manner. Partial submittals will not be accepted. Submittals shall include, but not be limited to: equipment, diffusers, pumps, piping, and
boilers.
Insulation
18. Insulate all new heating water, domestic hot water, domestic hot water recirculation, radiant floor (mains and runouts to areas being heated)
and snowmelt piping (mains and runouts to areas being heated) with U.L. approved, white, all service, glass fiber, snap-on, pipe insulation.
Minimum R-Value of 3.0 for all piping. Insulate fittings with glass fiber blanket insulation and premolded PVC covers. Provide deduct
alternate price to insulate with Armaflex.
19. Insulation shall be installed under all radiant heated floors on slab. Insulation shall be Insul-Tarp (manufactured by Insulation Solutions) and
shall have a minimum R-value of 5.9 at a mean testing temperature of 75 F.
20. Insulation shall be installed under all exterior snowmelt areas. Insulation shall be Dow Styrofoam Highload 60 extruded polystyrene foam
board insulation that has an R-5 per inch insulation value, 60 psi compressive strength rating, and 2" thick. Insulation installed under traffic
areas must be traffic rated.
21. Insulation for all types of piping shall be carried full size through pipe hangers or pipes shall be supported with vibration clamps.
22. Snowmelt distribution piping buried outside shall be insulated with 2" flexible, closed-cell elastomeric insulation, AP Armaflex or equal.
Product must meet requirements of ASTM C 534. Insulation shall have a maximum thermal conductivity of 0.27 Btu-in/h-ft2F at 75 F mean
temperature. Buried insulation shall be wrapped in a waterproof tape, e.g. Densotape or approved equal.
23. All buried snowmelt piping shall be either A) Pre-insulated PEX piping, Urecon or equivalent or B) Insulated with Armaflex or equivalent
and run inside a watertight conduit. Bury minimum 4' deep.
24. Internally line all new ductwork inside the thermal envelope (unless noted otherwise) with 1/2" thick, 2.0 PCF, U.L. rated, glass fiber
insulation with a continuous vapor barrier.
25. ([WHUQDOO\ZUDSDOOXQOLQHGGXFWZRUNZLWK´WKLFNLQVXODWLRQZLWKDFRQWLQXRXVYDSRUEDUULHU
26. Externally wrap all outside air ductwork with 2" thick insulation with a continuous vapor barrier.
27. ,QVXODWHWUDQVIHUGXFWVZLWK´WKLFN3&)JODVVILEHUGXFWOLQHU2ZHQV&RUQLQJ$HURIOH[RUHTXLYDOHQW
28. 5HIULJHUDQWSLSLQJ ,QVXODWHVXFWLRQSLSHEHORZWKHURRIDQGDOOEXULHGSLSHZLWK³$UPDIOH[´RUHTXLYDOHQWWXEXODUFORVHGFHOOIRDPLQVXODWLRQ
ò´WKLFN6OLSLQVXODWLRQRYHUSLSHEHIRUHDVVHPEO\VRWKDWWKHUHDUHQROHQJWKZLGHVHDPV:KHUHOHQJWKVRILQVXODWLRQDUHEXWWHGWRJHWKHU
XVHIDFWRU\UHFRPPHQGHGDGKHVLYH:KHUHWKHXVHRI³$UPDIOH[´RUHTXLYDOHQWWXEXODUFORVHGFHOOIRDPLQVXODWLRQLQSOHQXPVHWFLV
restricted by various codes (such as Denver) piping and fittings shall be insulated the same as domestic cold water piping.
Piping
29. Domestic Hot, Cold & Recirculation piping inside building - Type 'L' copper water tube, wrought copper fittings and no lead solder. Provide
alternate pricing for PEX tubing (no oxygen diffusion barrier necessary). Unless otherwise noted, piping on plans has been sized for copper,
DQGLI$6703(;SLSLQJLVXVHGLQFUHDVHVL]HRISLSLQJRQHQRPLQDOVL]HIURPVL]HVKRZQRQSODQVLH3ODQVFDOOIRUDô´OLQHߙ3(;LVWR
EHVXEVWLWXWHGD´3(;OLQHVKDOOEHLQVWDOOHG
30. Water service pipe outside building - Polyethylene (PE) plastic pipe (ASTM D2239) or tubing (ASTM D2737) and fittings (ASTM D2609)
VKDOOFRQIRUPWR16)DQGKDYHDPLQLPXPZRUNLQJSUHVVXUHRISVLDW)RUSUHVVXUHUDWLQJWRH[FHHGPD[LPXPZRUNLQJSUHVVXUH
31. Waste & Vent piping inside building:
Waste lines above ground - Standard weight, C.I. soil pipe, and fittings, or hubless, C.I. soil pipe and fittings. Up through 2-1/2" may be
standard weight, galvanized steel pipe with black, C.I. drainage fittings.
Waste lines below grade and all Vent lines for residential may be Schedule 40 ABS-DWV plastic pipe and fittings (ASTM D2661) or
Schedule 40 PVC-DWV plastic pipe and fittings (ASTM D2665). All pipe and fittings shall bear NFS-DWV mark and shall be joined with
solvent weld joints as recommended by the manufacturer.
32. Heating Water piping - Type 'L' copper, wrought copper fittings, and no lead solder. All buried pipe shall be surrounded with 4" of clean
sand. Provide alternate price for PEX tubing (with oxygen diffusion barrier). Unless otherwise noted, piping on plans has been sized for
FRSSHUDQGLI3(;SLSLQJLVXVHGLQFUHDVHVL]HRISLSLQJRQHQRPLQDOVL]HIURPVL]HVKRZQRQSODQVLH3ODQVFDOOIRUô´SLSLQJߙ3(;LVWR
EHVXEVWLWXWHGD´3(;OLQHVKDOOEHLQVWDOOHG
33. PEX piping shall be supported by continuous cradles supplied by the manufacturer.
34. Snowmelt distribution piping buried underground outdoors shall be sized per plans and shall be PEX-a crosslinked polyethylene with an
oxygen diffusion barrier, manufactured by the Engle method.
35. Drain Pan piping - Type 'M' copper, wrought copper fittings, and no lead solder. Drain pan piping may also be PEX or Schedule 40
ABS-DWV plastic pipe and fittings (ASTM D2661) or Schedule 40 PVC-DWV plastic pipe and fittings (ASTM D2665).
36. Condensing Boiler Condensate shall be neutralized via a neutralization basin before discharge into building drainage system. Condensate
piping shall be PVC or other approved material suitable for pH levels of 3.
37. Refrigeration Piping - Type 'L', ACR Grade copper, cleaned, dehydrated, capped and charged with clean nitrogen at the factory. Use wrought
copper fittings and hard solder having a minimum melting point of 1100F for buried lines, no lead solder for non-buried lines. Valves and
VSHFLDOWLHVVKDOOEHVWDQGDUGEUDVVRUEURQ]HYDOYHVIRUUHIULJHUDWLRQVHUYLFH%XULHGSLSHVKDOOEHVXUURXQGHGE\´FOHDQVDQG
38. Gas Piping - Schedule 40 black steel pipe, 150 lb. malleable iron screwed fittings on above ground pipe, welded fittings with all piping coated
and wrapped on buried pipe. CSST pipe is prohibited entirely.
39. Gas Valves - Lubricated plug valve 175 lb. W.O.G. iron screwed or flanged.
40. Copper pipe Valves and Specialties:
Gate Valves: Bronze, Class 125, 200 lb. W.O.G.
Ball Valves: Bronze, Class 125, 200 lb. W.O.G.
Check Valves: Bronze, Class 125, 200 lb. W.O.G.
Balancing Valves: 125 psig w.p. for 250F service tight shut-off, Illinois dual-purpose, balancing/shut-off valve, Hoffman, Sarco, or
equivalent.
41. Support pipe with rod and clevis or clamps. No pipe tape allowed.
42. Provide expansion joints or loops on all heating water piping runs in excess of 50'.
43. Dielectric Unions - Furnish and install a dielectric union at all connections where non-ferrous material is in contact with ferrous material and
fluid in not protected with corrosion inhibitors.
44. *UDGHDQGYDOYHDOOKHDWLQJZDWHUSLSLQJZLWKô´KRVHHQGYDOYHVWRSHUPLWGUDLQDJHRIWKHV\VWHP9HQWDOOKLJKSRLQWVLQHTXLSPHQWURRPV
as necessary with automatic air vents piped to convenient drain. All high points in system outside of equipment rooms with manual air vents
as required to relieve air in the system.
45. Provide plastic grommets on all heating water piping passing through wood joists and studs.
46. Install plumbing clean-outs as required by applicable codes.
Boiler Flue & Combustion Air Piping
47. Boiler flue piping shall be CPVC, complying with ASTM F441.
48. Boiler combustion air piping shall be PVC, complying with ASTM D1785.
Antifreeze Solutions
49. )LOOKHDWLQJZDWHUV\VWHPZLWKSURS\OHQHJO\FROZDWHUVROXWLRQE\YROXPHIRUIUHH]HSURWHFWLRQWR)DQGEXUVWSURWHFWLRQWR
),QFOXGHFRUURVLRQLQKLELWRUV
50. )LOOVQRZPHOWZDWHUV\VWHPZLWKSURS\OHQHJO\FROZDWHUVROXWLRQE\YROXPHIRUIUHH]HSURWHFWLRQWR)DQGEXUVWSURWHFWLRQWR
),QFOXGHFRUURVLRQLQKLELWRUV
Ductwork
51. Duct sizes shown on drawings are outside (sheet metal) duct dimensions.
52. All ductwork shall be sealed airtight with duct mastic. Duct tape is prohibited.
53. All returns shall be ducted. Panning of stud cavities, joist bays, etc. is not allowed.
54. Provide 1/4" galvanized mesh screen on all combustion air ducts or openings.
55. Seal all ductwork joints and vapor barrier penetrations at all exterior walls.
56. Ducts and piping penetrating through roof shall have roof flashing with caulk type counter flashing sleeve or by method acceptable by roofing
manufacturer. Installation shall be watertight.
57. Provide backdraft dampers at any and all ductwork penetrations through exterior wall (except outside air and combustion air ductwork).
58. Provide turning vanes in all mitered rectangular elbows.
59. Provide volume dampers at all accessible round duct take-offs.
60. Make all final connections to supply GRD's with acoustic flexible duct. Minimum length shall be 4 feet. Maximum length shall be 8 feet.
61. All ductwork or surfaces which are visible behind a grille, register, diffuser or louver shall be painted flat black.
62. $OOGU\HUYHQWVDQGEDWKURRPH[KDXVWGXFWVIURPIDQOLJKWIL[WXUHVVKDOOEH´JDOYDQL]HGURXQGߛXQOHVVQRWHGRWKHUZLVHߜ
63. Sheet metal and fittings to be pursuant to SMACNA and ASHRAE standards.
64. All ducts shall be 26 gauge minimum. Duct gauge and construction shall conform to SMACNA HVAC Duct Construction Standards.
65. Contractor to coordinate exact location of grilles and registers before installation.
66. Seal off all ducts during construction.
Vibration Isolation
67. Where specified, duct-to-fan connections shall be made with flexible canvas duct connector material. Provide duct alignment within 1/2" at
the fan collar and duct collar.
68. Where specified, spring vibration isolators for support of equipment shall be properly aligned so that support rod does not contact spring
housing.
Controls
69. Mount all humidistats 5'-0" above finished floor.
70. Thermostats & remote temperature sensors shall not be installed above heat emitting equipment, including wall mounted touch screen
controls. Do not mount on exterior walls or above/below forced air supply registers.
71. All thermostats shall have a temperature range suitable for the application and have adjustable set points. The thermostats shall be able to
display temperature setpoint and room temperature. All thermostats shall be approved by the Owner.
72. Freeze Detection Thermostats. Each supply system with water coils taking outside air shall have a freeze detection thermostat located on the
downstream side of the coil. Thermostats shall be of adjustable electric contact type, silver plated, manual reset with 20' flexible sensing bulb
of increment type with any section capable of actuating mechanism on temperature drop below set point, thermostat shall stop fan(s) and close
outside air damper. They shall have an isolated set of contacts for alarm system.
73. See Sequence of Operation for additional control information.
Balancing
74. Air and water flows must be balanced, and fan belts, pumps, and drive systems adjusted as required. Balance Contractor shall furnish
subsequent air balances after acceptance of the building.
75. Submit a written balance report. Balancing procedures shall be in accordance with NEBB or AABC guidelines for proportional balance.
Submit report on standard NEBB forms.
76. Airside measurements shall include all motor amperage, voltage readings, motor RPM, fan RPM, fan CFM, fan inlet static pressure, fan outlet
static pressure, and exhaust grille CFM.
77. Hydronic measurements shall include all motor amperage, voltage readings, motor RPM, pump RPM, pump GPM as calculated from the
pump curve, inlet and outlet pressures at pumps, and temperature and pressure drop at all coils.
78. Adjust flows to within 10% of required quantity. If actual quantity is less than 90% of design, investigate cause, attempt to rectify and notify
Engineer. Submittal of balance report with less than required flows without explanation is cause for rejection of report.
79. Submit three copies of all submittals in addition to any required by the Contractor. These copies shall be retained by the Owner, Contractor
and Engineer.
Radiant Floor Heating
80. Radiant tubing shall be 1/2" nominal diameter. Tubing shall be PEX-a crosslinked polyethylene with an oxygen diffusion barrier,
manufactured by the Engle method.
81. Piping shall be installed in continuous loops, no splices allowed. Tube centers and the maximum loop lengths are specified in the Radiant
Zone Schedule on the plans.
82. Tubing loops off each manifold shall be installed in equivalent lengths (+/- 5%).
83. The Contractor shall install manifolds as provided by the tubing manufacturer. The manifolds shall consist of a return header (including:
balancing valve for each loop, compression fitting to receive tubes and air vent) and supply header (including: manual shut-off valve for each
loop and compression fitting to receive tubes).
Snowmelt
84. Snowmelt tubing shall be 5/8" nominal diameter. Tubing shall be PEX-a crosslinked polyethylene with an oxygen diffusion barrier,
manufactured by the Engle method.
85. Piping shall be installed in continuous loops, no splices allowed. Tube centers and the maximum loop lengths are specified in the Snowmelt
Zone Schedule on the plans.
86. Tubing loops off each manifold shall be installed in equivalent lengths (+/- 5%).
87. The Contractor shall install manifolds as provided by the tubing manufacturer. The manifolds shall consist of a return header (including:
balancing valve for each loop, compression fitting to receive tubes and air vent) and supply header (including: manual shut-off valve for each
loop and compression fitting to receive tubes).
88. Secure piping in snowmelt areas by attaching tubing to wire mesh using plastic tie straps, every 3' on straight runs and at apex of turn for any
change of direction. No metal wiring shall be used.
89. Snowmelt system shall be pressure tested in accordance with tubing manufacturer's instructions as required for warranty protection. In the
absence of manufacturer's instruction, pressurize the entire snowmelt system with compressed air. Charge system to a pressure of not less than
80 psig or more than 100 psig. Pressure test shall last for 24 hours with not less than a 2 psig drop. With system air charged, soap test all
joint on and within the manifolds. After hydrostatic test pressure has been applied, examine piping, joints and connections for leakage.
Eliminate any leaks as necessary & re-test. Any portion of tubing layout that rises as a result of being pressurized shall be re-secured to be at
the proper level within the slab structure when poured.
90. Entire snowmelt system shall be left pressurized with monitoring pressure gauge throughout installation of concrete or sand/pavers.
Continually monitor pressure on system to make certain tubing system remains intact with no leaks or punctures.
91. Manifolds shall be tagged to identify area served. Each connection on supply & return manifolds shall be permanently labeled with loop
number.
92. Prior to final system fill and commissioning, the PEX tubing system and manifolds shall be chemically cleaned as prescribed by the tubing
manufacturer. Supply all tools, connections, labor, and accessories necessary to properly remove all foreign material, chemical, and residue
within the tubing system before permanently charging system and placing into operation.
93. After entire system has been properly cleaned and flushed, fill system with clean water to proper cold fill pressure. Add propylene glycol to
the snowmelt system to the concentration specified using a positive displacement pump. Antifreeze fluid shall include corrosion inhibitors.
Purge each individual loop to eliminate air pockets in the system. After purging remove fill connection to any potable water lines to prevent
any possibility of contamination.
Sequence of Operation
1. Controls
a. A Building Automation System (BAS) to control the lighting, AV, security, temperatures, etc. is anticipated for this project. Coordinate
with the General Contractor, Owner, and Home Automation Contractor to tie HVAC controls into the BAS. HVAC controls shall be based
on a Tekmar system.
b. Provide remote access via the internet (Tekmar 483 Gateway) with occupied/unoccupied functions.
c. Include Tekmar 479 3-button User Switch mounted in the Entry which allows Homeowner to change system scenes. Possible scene
settings are "Normal", "Unoccupied" and "Away". These same scenes can also be accessed from the internet webpage. Current scene is
indicated by green backlighting. Wall switch will automatically synchronize with the internet and vice versa.
d. Tekmar system shall control boiler plant (including water heaters and recirc pump), snowmelt, make-up air, radiant floor, fan coils, and
spa heating.
2. Thermostats
a. 6HH³7KHUPRVWDW6FKHGXOH´RQVKHHW0WRGHWHUPLQHZKLFKVWDWVSHUIRUPZKLFKIXQFWLRQV7KHUPRVWDWVVKDOOEH7HNPDUW\SH
Thermostats will control radiant floors & fan coils.
b. Thermostats shall connect to Tekmar Zone Managers and Expansion Modules as necessary.
3. B-1 & B-2 Boilers
a. Boilers shall be staged, modulated, and rotated by integral Lochinvar controls.
b. %RLOHUVVKDOOPDLQWDLQ+:6VHWSRLQWDWWHPSHUDWXUHVHQVRU76+:6VHWSRLQWVKDOOEHUHVHWEDVHGRQRXWGRRUWHPSHUDWXUHVߛ)#
)WR #)ߜ
c. +:6VHWSRLQWVKDOOEHUDPSHGXSWR)RQDQ\FDOOIRUGRPHVWLFKRWZDWHUKHDWLQJ
d. +:6VHWSRLQWVKDOOEHUDPSHGXSWR)GXULQJDFDOOIRUNLWFKHQPDNHXSDLUDWIDQFRLO)&
e. P-1 & P-2 boiler pumps shall run whenever associated boiler is firing.
4. B-3 Boiler
a. Boiler shall be modulated by integral Lochinvar controls.
b. %RLOHUVKDOOPDLQWDLQ+:6VHWSRLQWRI)ߛDGMߜDWWHPSHUDWXUHVHQVRU76
c. P-9 boiler pump shall run whenever associated boiler is firing.
5. WH-1 & WH-2 Indirect Water Heaters
a. Upon a call for heating from associated temperature sensor, associated water heater pump shall start.
b. %RLOHU+:6VHWSRLQWVKDOOEHUDPSHGXSWR)
c. P-10 domestic hot water recirculation pump shall be controlled by integral timer & aquastat. Provide a manual shut-off switch for
unoccupied periods.
6. Radiant Floor & KSH-1 Kickspace Heater
a. Upon a call for heating, associated on/off control valve shall open and P-7 radiant pump shall start.
b. 09PL[LQJYDOYHVKDOOUHVHWEDVHGRQRXWGRRUWHPSHUDWXUHVߛ)#)WR)#)ߜ
c. In the case of KSH-1, the fan shall start upon a call for second stage heat as the coil will already be flowing.
d. Radiant floor heating shall be the first stage of heating. Fan coils and KSH-1 shall be second stage of heat.
7. FC-1, 3, & 4 Fan Coils
a. Heating: Upon a call for heating, fan shall start, associated on/off control valve shall open to flow coil and P-6 pump shall start. Fan coils
shall provide second stage of heating (radiant is first stage).
b. Cooling: Upon a call for cooling, fan shall start, and associated condensing unit shall be enabled.
8. FC-2 Fan Coil
a. Heating: Upon a call for heating, fan shall start, and P-5 pump shall start. Fan coil shall provide second stage of heating (radiant is first
stage).
b. Cooling: Upon a call for cooling, fan shall start, and condensing unit shall be enabled.
c. Make-up Air:
c.a. Fan shall be electrically interlocked to run whenever kitchen exhaust fan is on.
c.b. Upon activation of kitchen exhaust fan, normally closed OSA damper shall fully open, normally open RA damper shall fully close,
and FC-2 blower shall start.
c.c. Upon a call for heating from temperature sensor TS-4 downstream of fan coil discharge, P-5 pump shall start. Speed of P-5 pump
VKDOOEHYDULHGWRPDLQWDLQVXSSO\DLUWHPSHUDWXUHRI)ߛ7HNPDUPL[LQJH[SDQVLRQPRGXOHZGXFWPRXQWHGDLUVHQVRUߜ
c.d. 3SXPSVKDOOEHGLVDEOHGLIRXWGRRUWHPSHUDWXUHLVDERYH)RUGXULQJDFDOOIRUFRROLQJ
9. FC-5 Fan Coil
a. Heating: Upon a call for heating, fan shall start, on/off control valve shall open to flow coil and P-6 pump shall start. Normally open
motor operated damper at FC-5 shall be closed during calls for heating. Fan coil shall provide second stage of heating (radiant is first
stage). FC-5 VFD shall be set for approximately 500 cfm during calls for heating.
b. Cooling: Upon a call for cooling, fan shall start, and condensing unit shall be enabled. Normally open motor operated damper at FC-5 shall
remain open during calls for cooling. FC-5 VFD shall be set for approximately 910 cfm during calls for cooling.
10. HX-1 Spa Heat Exchanger
a. Upon a call for heating from spa temperature sensor TS-6, associated control valve shall open, P-8 pump shall start and boilers shall be
HQDEOHG3URYLGHD7HNPDUVHWSRLQWFRQWUROOHU'XULQJ1RUPDOPRGHLQWKH71V\VWHPVHWSRLQWVKDOOEHDSSUR[LPDWHO\)
ߛDGMߜ'XULQJ$ZD\PRGHLQWKH71V\VWHPVHWSRLQWVKDOOEHVHWEDFNWRDSSUR[LPDWHO\)ߛDGMߜ
11. Snowmelting
a. Provide (1) Tekmar 664 automatic snowmelting control (or equal) with a Tekmar 090 and 091 snow/ice sensor.
b. Upon a call for snowmelting from snow/ice sensor, pumps P-11, P-12, P-13 & P-14 shall start.
c. 7KHWZR³VQRZPHOW]RQHV´DUH]RQHVLQWKHVHQVHWKDWHDFKKDVDGHGLFDWHGSXPSDQGFDQPDQXDOO\EHWXUQHGWRDXWRRURIIߛSHUEHORZߜ
There is only one snow/ice sensor in total.
d. $OVRSURYLGHLQGLYLGXDO³DXWRRII´ZDOOVZLWFKHVIRUHDFK]RQHSXPSORFDWHGDWSXPSDQGODEHOHG³$XWR´PRGHVPHDQVDXWRPDWLFDOO\
FRQWUROOHGE\7HNPDU³2II´PHDQVSXPSLVRII
e. 7HNPDUFRQWUROVKDOOEHVHWXSIRU::6'ߛZDUPZHDWKHUVKXWGRZQߜDWDSSUR[LPDWHO\)ߛDGMߜ6\VWHPVKDOOQRWRSHUDWHLIRXWGRRU
temperature is above this setting.
12. Fans
a. EF-1 bath exhaust fans shall each be controlled by a separate wall switch.
b. EF-2 garage exhaust fan shall be interlocked with the garage doors. Upon the opening/closing of any garage door, the fan shall run for 30
minutes (adj). Any opening/closing of a garage door during the 30 minute run period shall reset the timer. Also include a wall switch (6
hour timer) for manual operation.
c. SF-1 mechanical room supply fan shall be controlled by a line voltage wall mounted cooling thermostat.
d. SF-2 mechanical room supply fan shall be controlled by a line voltage wall mounted cooling thermostat.
13. ERV-1 Energy Recovery Ventilator
a. ERV-1 shall be automatically controlled by multiple occupancy sensors mounted in the ceiling. Sensor shall be set for maximum
sensitivity and shall include a time delay feature such that when motion is no longer sensed, the unit shall continue to run for 30 minutes
(adj).
b. Occupancy sensor shall be a Watt Stopper DT-355 dual technology line voltage ceiling sensor, or approved equal.
c. Unit shall also be controlled by multiple local push button controls (PB-L Push Button Point-of-use Control Lighted). These controls shall
all be wired in parallel with each other and with the occupancy sensors.
14. H-1, 2, & 3 Steam Humidifiers
a. Upon a call for humidification from wall mounted humidistat, associated blower shall start and once airflow is proven by air proving
switch, humidifier shall start.
b. Include a high limit duct humidistat located in the supply air duct, downstream of the steam absorption zone, to disable humidifier if RH
exceeds 80% (adj).
c. Include an automatic humidifier control from humidifier manufacturer, which shall automatically reset the humidity setpoint based on
outdoor temperature. Outdoor reset curve shall be adjustable. Include outdoor air temperature sensor.
d. Humidification shall be disabled during calls for cooling.
15. SP-1 Sump Pump (Elevator Pit)
a. Pump shall be controlled by integral controls and sensors. Pump shall be disabled from operating if oil is sensed by oil sensor. Alarms
shall be generated during high water condition or if oil is detected. Dry contacts shall be used to signal the Control 4 home automation
system of an alarm.
16. LS-2 Lift Station
a. Duplex pumping station shall be controlled by integral float switches and controls.
b. When the "stop" and "lead" floats are closed pump 1 will start and the pump 1 run light will illuminate. Pump 1 will remain operational
until the "stop" float opens.
c. The next time the "stop" and "lead" floats are closed the alternating circuit will energize pump 2 and the pump 2 run light will illuminate.
Pump 2 will remain operational until the "stop" float opens. This cycle will repeat each time the fluid level rises and falls.
d. If the fluid level continues to rise after the first pump has been energized the "lag" float will close. When the "lag" float has closed the
second pump will energize. Both pumps will remain operational until the "stop" float opens.
e. In a four float system when the "alarm" float is closed the following will also occur:
- the external high water light will illuminate
- the audible high water alarm will sound
- the auxiliary dry contacts will close. A signal shall be sent to the BAS.
17. Pumps
a. P-1 shall run whenever B-1 boiler is called to fire.
b. P-2 shall run whenever B-2 boiler is called to fire.
c. P-3 shall run whenever there is a call for heat from TS-2 temperature sensor at WH-1 water heater.
d. P-4 shall run whenever there is a call for heat from TS-3 temperature sensor at WH-2 water heater.
e. P-5 shall run whenever there is a call for heating from TS-4 temperature sensor at FC-2 discharge or second stage heating.
f. P-6 shall run whenever there is a call for heating from FC-1, 3, 4, or 5 fan coils.
g. P-7 shall run whenever there is a call for radiant floor or kickspace heating.
h. P-8 shall run whenever there is a call for heat from TS-6 temperature sensor at HX-1 spa heat exchanger.
i. P-9 shall run whenever B-3 boiler is called to fire.
j. 3VKDOOUXQZKHQHYHUWKHUHLVDFDOOIRUVQRZPHOWLQJ5HIHUWR³6QRZPHOWLQJ´VHTXHQFHIRUPRUHLQIRUPDWLRQ
k. 3VKDOOUXQZKHQHYHUWKHUHLVDFDOOIRUVQRZPHOWLQJ5HIHUWR³6QRZPHOWLQJ´VHTXHQFHIRUPRUHLQIRUPDWLRQ
l. 3VKDOOEHFRQWUROOHGE\WKH7HNPDUV\VWHP3XPSVKDOOEHRQGXULQJ³RFFXSLHG´PRGHDQGVKDOOEHRIIGXULQJ³XQRFFXSLHG´PRGH
2/3/15
07/31/15